Parathyroid Hormone (1-34) (huma

Confirm delete?

Parathyroid Hormone (1-34) (human) (trifluoroacetate salt)

Zoom

Cat No: 24985

Biochemicals - Peptides

Parathyroid hormone (PTH) (1-34) is an N-terminal fragment of PTH that regulates bone remodeling.{41734} It is a PTH receptor agonist that binds to the PTH1 receptor (IC50 = 2 nM) and increases cAMP accumulation (IC50 = 0.22 pM) in HEK293 cells expres...

This product can only be bought through Cayman Chemical. Please contact us.

Product Overview
Data
Downloads
About Cayman

Territorial Availability: Available through Bertin Technologies only in France

Synonyms:

L-seryl-L-valyl-L-seryl-L-?-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-L-asparaginyl-L-seryl-L-methionyl-L-?-glutamyl-L-arginyl-L-valyl-L-?-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-?-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-phenylalanine, trifluoroacetate salt

Correlated keywords:

54651-28-4 64428-48-4 70212-84-9 267417-73-2 289470-84-4 52232-67-4 Osteotide Parathar Parathormone Teriparatide ZT 034 ZT034 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF LY-333334

Product Overview:
Parathyroid hormone (PTH) (1-34) is an N-terminal fragment of PTH that regulates bone remodeling.{41734} It is a PTH receptor agonist that binds to the PTH1 receptor (IC50 = 2 nM) and increases cAMP accumulation (IC50 = 0.22 pM) in HEK293 cells expressing human PTH1.{41735} PTH (1-34) also stimulates cAMP accumulation in Saos-2 human osteoblast-like cells (IC50 = 0.38 nM) and bone resorption from neonatal mouse calvariae in vitro. In vivo, PTH (1-34) (40 µg/kg per day) increases bone mass in an ovariectomized adult rat model of postmenopausal osteoporosis.{41736} It also increases proteoglycan content and inhibits articular cartilage degeneration in knee joints in a mouse model of injury-induced osteoarthritis when administered at a dose of 40 µg/kg per day immediately following injury.{41737} Formulations containing PTH (1-34) have been used in the treatment of osteoporosis in men and postmenopausal women who are at high risk for fracture.

Size	1 mg
Shipping	dry ice
Molecular Formula	C₁₈₁H₂₉₁N₅₅O₅₁S₂ • XCF₃COOH
SMILES	[H]N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CCCCN)C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N
Molecular Weight	4117,7
Formulation	A lyophilized powder
Purity	≥95%
Custom Code	3504.00
UNSPSC code	12352100

Technical File

MSDS

Click here to ask for your quote and get 15% off Cayman's products.

Cayman Chemical's mission is to help make research possible by supplying scientists worldwide with the basic research tools necessary for advancing human and animal health. Our utmost commitment to healthcare researchers is to offer the highest quality products with an affordable pricing policy.

Our scientists are experts in the synthesis, purification, and characterization of biochemicals ranging from small drug-like heterocycles to complex biolipids, fatty acids, and many others. We are also highly skilled in all aspects of assay and antibody development, protein expression, crystallization, and structure determination.

Over the past thirty years, Cayman developed a deep knowledge base in lipid biochemistry, including research involving the arachidonic acid cascade, inositol phosphates, and cannabinoids. This knowledge enabled the production of reagents of exceptional quality for cancer, oxidative injury, epigenetics, neuroscience, inflammation, metabolism, and many additional lines of research.

Our organic and analytical chemists specialize in the rapid development of manufacturing processes and analytical methods to carry out clinical and commercial GMP-API production. Pre-clinical drug discovery efforts are currently underway in the areas of bone restoration and repair, muscular dystrophy, oncology, and inflammation. A separate group of Ph.D.-level scientists are dedicated to offering Hit-to-Lead Discovery and Profiling Services for epigenetic targets. Our knowledgeable chemists can be contracted to perform complete sample analysis for analytes measured by the majority of our assays. We also offer a wide range of analytical services using LC-MS/MS, HPLC, GC, and many other techniques.

Accreditations
ISO/IEC 17025:2005
ISO Guide 34:2009

Cayman is a leader in the field of emerging drugs of abuse, providing high-purity Schedule I-V Controlled Substances to federally-licensed laboratories and qualified academic research institutions for forensic analyses. We are certified by ACLASS Accreditation Services with dual accreditation to ISO/IEC 17025:2005 and ISO Guide 34:2009.