Confirm delete?

Bertin Bioreagent
logo
All categories
Contact Us
You are here :

AIF Blocking Peptide

  • Photo non disponible
Cat No: 360773
Antibodies - Blocking Peptides
Cayman

Each vial contains 200 µg of lyophilized peptide derived from the human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW). This peptide was used as an antigen for production of Cayman’s AIF polyclonal antibody (Catalog No. 160773) and can be us...

More
: 1 ea

This product can only be bought through Cayman Chemical. Please contact us.

Territorial Availability: Available through Bertin Technologies only in France
Correlated keywords:
  • human peptides controls factors WB western blots blotting antibodies apoptosis
Product Overview:
Each vial contains 200 µg of lyophilized peptide derived from the human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW). This peptide was used as an antigen for production of Cayman’s AIF polyclonal antibody (Catalog No. 160773) and can be used in conjunction with this antibody to block protein-antibody complex formation during analysis for AIF · Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.{10026,8815} Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis.{6767} When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage.{7005,10024,9739} AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines.
Size 1 ea
Shipping dry ice
Formulation 200 µg lyophilized peptide
Custom Code 3504.00
UNSPSC code 41105329

Click here to ask for your quote and get 15% off Cayman's products.

 

Cayman Chemical's mission is to help make research possible by supplying scientists worldwide with the basic research tools necessary for advancing human and animal health. Our utmost commitment to healthcare researchers is to offer the highest quality products with an affordable pricing policy.

Our scientists are experts in the synthesis, purification, and characterization of biochemicals ranging from small drug-like heterocycles to complex biolipids, fatty acids, and many others. We are also highly skilled in all aspects of assay and antibody development, protein expression, crystallization, and structure determination.

Over the past thirty years, Cayman developed a deep knowledge base in lipid biochemistry, including research involving the arachidonic acid cascade, inositol phosphates, and cannabinoids. This knowledge enabled the production of reagents of exceptional quality for cancer, oxidative injury, epigenetics, neuroscience, inflammation, metabolism, and many additional lines of research.

Our organic and analytical chemists specialize in the rapid development of manufacturing processes and analytical methods to carry out clinical and commercial GMP-API production. Pre-clinical drug discovery efforts are currently underway in the areas of bone restoration and repair, muscular dystrophy, oncology, and inflammation. A separate group of Ph.D.-level scientists are dedicated to offering Hit-to-Lead Discovery and Profiling Services for epigenetic targets. Our knowledgeable chemists can be contracted to perform complete sample analysis for analytes measured by the majority of our assays. We also offer a wide range of analytical services using LC-MS/MS, HPLC, GC, and many other techniques.

Accreditations
ISO/IEC 17025:2005
ISO Guide 34:2009

Cayman is a leader in the field of emerging drugs of abuse, providing high-purity Schedule I-V Controlled Substances to federally-licensed laboratories and qualified academic research institutions for forensic analyses. We are certified by ACLASS Accreditation Services with dual accreditation to ISO/IEC 17025:2005 and ISO Guide 34:2009.

/ We also advise you

Cross selling for this product : AIF Blocking Peptide There are 3 products.

Search