Acetyl PACAP (1-38) (human, mous

Confirm delete?

Acetyl PACAP (1-38) (human, mouse, ovine, porcine, rat) (trifluoroacetate salt)

Zoom

Cat No: 24774

Biochemicals - Peptides

Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38) (Item No. 24770).{41742} It binds to the PACAP receptor PAC1 (IC50 = 5.6 nM for the human receptor) and induces calcium mobilizatio...

This product can only be bought through Cayman Chemical. Please contact us.

Product Overview
Data
Downloads
About Cayman

Territorial Availability: Available through Bertin Technologies only in France

Synonyms:

N-acetyl-L-histidyl-L-seryl-L-?-aspartylglycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-?-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucylglycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-L-lysinamide, trifluoroacetate salt

Correlated keywords:

156106-32-0 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK DPP4

Product Overview:
Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38) (Item No. 24770).{41742} It binds to the PACAP receptor PAC1 (IC50 = 5.6 nM for the human receptor) and induces calcium mobilization and proliferation of PC12 cells (EC50s = 4.4 and 0.83 nM, respectively) with an efficacy comparable to PACAP (1-38). Acetyl PACAP (1-38) is resistant to degradation by dipeptidyl peptidase 4 (DPP-4) with a 10-fold longer half-life than PACAP (1-38), respectively.

Size	500 µg
Shipping	dry ice
Molecular Formula	C₂₀₅H₃₃₃N₆₃O₅₄S • XCF₃COOH
SMILES	NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=C(C=C1)O)NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](C)NC([C@H](C)NC([C@@H](NC([C@H](CC2=CC=C(C=C2)O)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC([C@H](CCSC)NC([
Molecular Weight	4576,3
Formulation	A lyophilized powder
Purity	≥95%
Custom Code	3504.00
UNSPSC code	12352100

Technical File

MSDS

Click here to ask for your quote and get 15% off Cayman's products.

Cayman Chemical's mission is to help make research possible by supplying scientists worldwide with the basic research tools necessary for advancing human and animal health. Our utmost commitment to healthcare researchers is to offer the highest quality products with an affordable pricing policy.

Our scientists are experts in the synthesis, purification, and characterization of biochemicals ranging from small drug-like heterocycles to complex biolipids, fatty acids, and many others. We are also highly skilled in all aspects of assay and antibody development, protein expression, crystallization, and structure determination.

Over the past thirty years, Cayman developed a deep knowledge base in lipid biochemistry, including research involving the arachidonic acid cascade, inositol phosphates, and cannabinoids. This knowledge enabled the production of reagents of exceptional quality for cancer, oxidative injury, epigenetics, neuroscience, inflammation, metabolism, and many additional lines of research.

Our organic and analytical chemists specialize in the rapid development of manufacturing processes and analytical methods to carry out clinical and commercial GMP-API production. Pre-clinical drug discovery efforts are currently underway in the areas of bone restoration and repair, muscular dystrophy, oncology, and inflammation. A separate group of Ph.D.-level scientists are dedicated to offering Hit-to-Lead Discovery and Profiling Services for epigenetic targets. Our knowledgeable chemists can be contracted to perform complete sample analysis for analytes measured by the majority of our assays. We also offer a wide range of analytical services using LC-MS/MS, HPLC, GC, and many other techniques.

Accreditations
ISO/IEC 17025:2005
ISO Guide 34:2009

Cayman is a leader in the field of emerging drugs of abuse, providing high-purity Schedule I-V Controlled Substances to federally-licensed laboratories and qualified academic research institutions for forensic analyses. We are certified by ACLASS Accreditation Services with dual accreditation to ISO/IEC 17025:2005 and ISO Guide 34:2009.