Confirm delete?

Bertin Bioreagent
logo

Search

Contact Us

AIF Polyclonal Antibody

  • Photo non disponible
Cat No: 160773
Polyclonal&monoclonal Antibody - Miscellaneous Antibodies
Cayman
€319.00
Price is excluding VAT and does not include packaging neither shipping

Antigen: human AIF amino acids 151-180 • Host: rabbit • Cross Reactivity: (+) human, rat, and mouse AIF; other species not tested • Application(s): WB • Application(s): WB • AIF is a highly conserved mitochondrial protein with roles in redox-biochemi...

More
: 500 µl

This product can only be bought through Cayman Chemical. Please contact us.

- +
Territorial Availability: Available through Bertin Technologies only in Europe
Product Overview:
Antigen: human AIF amino acids 151-180 • Host: rabbit • Cross Reactivity: (+) human, rat, and mouse AIF; other species not tested • Application(s): WB • Application(s): WB • AIF is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.
Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis. Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis. When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage. AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines.
Size: 500 µl
Shipping: wet ice
Stability: Store at -20 degrees; shelf life 730 days maximum after production
Host: rabbit
Antigen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW)
Application(s):

WB

Formulation: Peptide affinity-purified IgG
Custom Code: 3822000002
UNSPSC code: 12352203

Cayman Chemical's mission is to help make research possible by supplying scientists worldwide with the basic research tools necessary for advancing human and animal health. Our utmost commitment to healthcare researchers is to offer the highest quality products with an affordable pricing policy.

Our scientists are experts in the synthesis, purification, and characterization of biochemicals ranging from small drug-like heterocycles to complex biolipids, fatty acids, and many others. We are also highly skilled in all aspects of assay and antibody development, protein expression, crystallization, and structure determination.

Over the past thirty years, Cayman developed a deep knowledge base in lipid biochemistry, including research involving the arachidonic acid cascade, inositol phosphates, and cannabinoids. This knowledge enabled the production of reagents of exceptional quality for cancer, oxidative injury, epigenetics, neuroscience, inflammation, metabolism, and many additional lines of research.

Our organic and analytical chemists specialize in the rapid development of manufacturing processes and analytical methods to carry out clinical and commercial GMP-API production. Pre-clinical drug discovery efforts are currently underway in the areas of bone restoration and repair, muscular dystrophy, oncology, and inflammation. A separate group of Ph.D.-level scientists are dedicated to offering Hit-to-Lead Discovery and Profiling Services for epigenetic targets. Our knowledgeable chemists can be contracted to perform complete sample analysis for analytes measured by the majority of our assays. We also offer a wide range of analytical services using LC-MS/MS, HPLC, GC, and many other techniques.

Accreditations
ISO/IEC 17025:2005
ISO Guide 34:2009

Cayman is a leader in the field of emerging drugs of abuse, providing high-purity Schedule I-V Controlled Substances to federally-licensed laboratories and qualified academic research institutions for forensic analyses. We are certified by ACLASS Accreditation Services with dual accreditation to ISO/IEC 17025:2005 and ISO Guide 34:2009.

/ We also advise you

Cross selling for this product : AIF Polyclonal Antibody There are 2 products.